DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG30323

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:207 Identity:41/207 - (19%)
Similarity:71/207 - (34%) Gaps:66/207 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRN--------------QPQYTHWVG----- 107
            |.:|.||::...||:|:..|.:.....|.|..::.:|              .|:..:.|.     
  Fly    51 NHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLD 115

  Fly   108 ----SG-------------------NFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYN 149
                ||                   ..:.....||..|.|.:...|..:|.:.::  ....|:::
  Fly   116 ESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYI--SAMCPAFS 178

  Fly   150 DRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQ----SDCSRSWSLHDNMICINTNGGK 210
            ..|.:...|:         .|| |....|..:..|.:|:    .||||       .:|:.:..|:
  Fly   179 MVYDNPVTWF---------QDG-PYSSELIQIRAQKISEYECKPDCSR-------CLCMTSYTGR 226

  Fly   211 -STCGGDSGGPL 221
             :.|..|.|.||
  Fly   227 GNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 41/207 (20%)
Tryp_SPc 38..262 CDD:238113 41/207 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 41/207 (20%)
Tryp_SPc 45..272 CDD:214473 41/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.