DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG30098

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:241 Identity:56/241 - (23%)
Similarity:99/241 - (41%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTN------------GASGVT 89
            |:..|..|  .:.|::..|:  .:..:.||||:|...:||||||||.            .:|..|
  Fly    36 RVIGGQNA--RRTPWMAYLI--RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT 96

  Fly    90 INYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQD 154
            .....|.|....|.|    .|::...:::...|..|..::...::....::....|.|..:..|:
  Fly    97 DGQTRSYRVVSIYRH----KNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQN 157

  Fly   155 YAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHDNMICINTNGGKSTCGGDSGG 219
            :     ..:|||.......:|..||.:.::.:....|    .:....||. .|..:..|.|||||
  Fly   158 F-----TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC----GVPSLSICC-WNPVQYACFGDSGG 212

  Fly   220 PL--VTHEGNRLV----GVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            ||  :...|::.:    |||:.| :..|...:.  :..:..|:.|:
  Fly   213 PLGSLVKYGHKTIYVQFGVTNSV-TGNCDGYSS--YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 55/239 (23%)
Tryp_SPc 38..262 CDD:238113 55/240 (23%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 55/238 (23%)
Tryp_SPc 37..258 CDD:238113 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.