DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG30091

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:112/270 - (41%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASG 87
            :|:|          :|..|..|.|.|.|::.  |...|..:.||||:|.|.:|||||||......
  Fly    32 QLIP----------KIVGGVDAGELKNPWMA--LIKTNDEFICGGSVITNKFVLTAAHCMCTDEE 84

  Fly    88 VTINYGASLRNQPQYT------HWVGSGNFVQHHH----YN-----------SGNLHNDISLIR- 130
            ..:.|       .|.|      |.:.:|   :|:|    ||           ..|..|||:|:| 
  Fly    85 CIVKY-------TQLTVTLGVYHLLATG---EHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRL 139

  Fly   131 ------TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQS 189
                  .|.:....::...:|....|..|::     .|.|||.|.:|. :.:.||.|.:..:.:.
  Fly   140 QKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRK 198

  Fly   190 DCSRS-WSLHD-NMICINTNGGKSTCGGDSGGPLVTH---EGNRLVGVTSFVSSAGCQSGAPAVF 249
            .|..: |...| .|.|..|..|:.||..||||||..|   :|.:.......||:.........::
  Fly   199 MCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMY 263

  Fly   250 SRVTGYLDWI 259
            :.|.|::|:|
  Fly   264 TDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 71/254 (28%)
Tryp_SPc 38..262 CDD:238113 72/255 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 71/254 (28%)
Tryp_SPc 37..276 CDD:238113 72/255 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.