DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG30090

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:101/267 - (37%) Gaps:93/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NGNWW-----------CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQY----------- 102
            |.|.|           |||::|...:|||||||.|..|.|.:..|       :|           
  Fly    49 NSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSAVKVRLG-------EYDDTATEDCNSK 106

  Fly   103 -------THWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDF---------------WHLVNKVE 144
                   .|.|...  .:|..::.....|||:|:| ...|.|               ..||:.:|
  Fly   107 ICIPRAEEHDVDMA--FRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE 169

  Fly   145 LPSYNDRYQDYAGWWAVASGWGGTYD----GSPLPDWLQAVDVQIMSQSDCSRSWS--LHDNMIC 203
                          |.||:|||.|..    |.     ||...:|..:.|.|.::..  :..|.||
  Fly   170 --------------WFVATGWGETRTHRTRGV-----LQITQLQRYNSSQCMQALGRLVQQNQIC 215

  Fly   204 INTNGGKSTCGGDSGGPL---VTH-EGNRLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWI--- 259
            .. ..|..||.|||||||   |.| :..|.|  ||.|: .|..| ||. .|::.|..|.|||   
  Fly   216 AG-RLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSY-GSREC-SGI-GVYTDVYSYADWIATV 276

  Fly   260 -RDNTGI 265
             :.||.:
  Fly   277 VQQNTHV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 73/255 (29%)
Tryp_SPc 38..262 CDD:238113 75/262 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/255 (29%)
Tryp_SPc 40..276 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.