DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Klk1b3

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:290 Identity:80/290 - (27%)
Similarity:123/290 - (42%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 67
            |.:||||::....|.|              .:|.|:..||.......|:.|.:.:.  |.:.|||
  Rat     8 LILFLALSLGRNDAAP--------------PVQSRVVGGYNCEMNSQPWQVAVYYF--GEYLCGG 56

  Fly    68 SIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGN------FVQHHHYNSGNLH--- 123
            .:|..:||:|||||      .|.||..          |:|..|      |.||...:....|   
  Rat    57 VLIDPSWVITAAHC------ATDNYQV----------WLGRNNLYEDEPFAQHRLVSQSFPHPGF 105

  Fly   124 -----------------NDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGG-TY 169
                             ||:.|:. :...|....|..::||....:    .|...:|||||. |.
  Rat   106 NQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPK----VGSTCLASGWGSITP 166

  Fly   170 DGSPLPDWLQAVDVQIMSQSDC--SRSWSLHDNMICI-NTNGGKSTCGGDSGGPLVTHEGNRLVG 231
            ||..|.|.||.|::.::|...|  :....:.|.|:|. ..:|||.||.|||||||:.:  ..|.|
  Rat   167 DGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICN--GVLQG 229

  Fly   232 VTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261
            :||:..:...:...|.:::::..:..||::
  Rat   230 ITSWGFNPCGEPKKPGIYTKLIKFTPWIKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 70/252 (28%)
Tryp_SPc 38..262 CDD:238113 71/255 (28%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 70/252 (28%)
Tryp_SPc 29..260 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.