DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Cela1

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:295 Identity:87/295 - (29%)
Similarity:126/295 - (42%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW- 64
            ::..||.:|.:...:....||            ...|:..|..|.....|..:.|.:...|:|: 
  Rat     2 LRFLVFASLVLYGHSTQDFPE------------TNARVVGGAEARRNSWPSQISLQYLSGGSWYH 54

  Fly    65 -CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYT-HWVGSGNFVQHHHYNSGNL--HND 125
             |||::|...||:|||||.:......:..|....:|...| .:|.....|.|.::||.|:  ..|
  Rat    55 TCGGTLIRRNWVMTAAHCVSSQMTFRVVVGDHNLSQNDGTEQYVSVQKIVVHPNWNSNNVAAGYD 119

  Fly   126 ISLIRTPHVDFWHLVNKVELPSY----------------NDRYQDYAGWWAVASGWGGTYDGSPL 174
            |:|:|        |...|.|.:|                |..|         .:|||.|.....|
  Rat   120 IALLR--------LAQSVTLNNYVQLAVLPQEGTILANNNPCY---------ITGWGRTRTNGQL 167

  Fly   175 PDWLQAVDVQIMSQSDCSRS--W--SLHDNMICINTNGGKSTCGGDSGGPL--VTHEGNRLVGVT 233
            ...||...:..:..|.||.|  |  ::...|:|...:|.:|.|.|||||||  :.:....:.|||
  Rat   168 SQTLQQAYLPSVDYSICSSSSYWGSTVKTTMVCAGGDGVRSGCQGDSGGPLHCLVNGQYSVHGVT 232

  Fly   234 SFVSSAGCQ-SGAPAVFSRVTGYLDWIRDNTGISY 267
            |||||.||. |..|.||:||:.|:.|:  |..|:|
  Rat   233 SFVSSMGCNVSRKPTVFTRVSAYISWM--NNVIAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 78/249 (31%)
Tryp_SPc 38..262 CDD:238113 78/251 (31%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 78/248 (31%)
Tryp_SPc 27..262 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.