DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Tpsb2

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:276 Identity:89/276 - (32%)
Similarity:122/276 - (44%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW---CGGS 68
            |:|..:...:.|.|..:.|           .|..|:.|.|.|.|:.|.|.|  ..|:|   ||||
Mouse    12 LSLLASLVYSAPRPANQRV-----------GIVGGHEASESKWPWQVSLRF--KLNYWIHFCGGS 63

  Fly    69 IIGNTWVLTAAHCTNGASGVTINYGASLRNQPQY--THWVGSGNFVQHHHYNSGNLHNDISL--I 129
            :|...||||||||..........:...||.|..|  ...:.....|.|.||.:.....|::|  :
Mouse    64 LIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLEL 128

  Fly   130 RTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPD--WLQAVDVQIMSQSDCS 192
            ..|.....|| :.:.||..::.:......|  .:|||...:..|||.  .|:.|.|.|:..|.|.
Mouse   129 EVPVNVSTHL-HPISLPPASETFPPGTSCW--VTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCD 190

  Fly   193 RSWS-----------LHDNMICINTNGGKSTCGGDSGGPLVTH-EGNRL-VGVTSFVSSAGC-QS 243
            |.:.           :||.|:|.. |..:.:|.||||||||.. :|..| .||.|:  ..|| |.
Mouse   191 RKYHTGLYTGDDFPIVHDGMLCAG-NTRRDSCQGDSGGPLVCKVKGTWLQAGVVSW--GEGCAQP 252

  Fly   244 GAPAVFSRVTGYLDWI 259
            ..|.:::|||.|||||
Mouse   253 NKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 82/244 (34%)
Tryp_SPc 38..262 CDD:238113 84/245 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.