DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG43742

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:244 Identity:74/244 - (30%)
Similarity:115/244 - (47%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASL 96
            |||..|:.||:.|...:   .:..|:: |..::||||:|...:|||||||......||::.|.:.
  Fly    29 VKITYRVANGHTAITSQ---FMAALYN-NSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENN 89

  Fly    97 RN--QPQYTHWVG-SGNFVQHHHYNSGNLHNDISLIR-------TPHVDFWHLVNKVELPSYNDR 151
            |:  .|...|.:. :...:.|.:::.....|||:|:|       ..|:....::...::.|.|..
  Fly    90 RSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQN 154

  Fly   152 YQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHDNMICINTNGGKSTCGGD 216
            .       ..|.|||.|..|: :.|.|..:|:..:.:|.|.:    :.|.||..:..| .||..|
  Fly   155 N-------FTAYGWGKTEHGN-ISDVLSFIDLVRLPKSMCYQ----NINTICAGSTSG-DTCESD 206

  Fly   217 SGGPLV---THEGNR---LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |||||:   .|.|..   |.|:||: ..|.| ||...|::.|..|..||
  Fly   207 SGGPLIGNFVHRGKSRDILFGITSY-GDAEC-SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 69/237 (29%)
Tryp_SPc 38..262 CDD:238113 70/238 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 69/237 (29%)
Tryp_SPc 35..256 CDD:238113 70/238 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.