DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG43335

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:248 Identity:72/248 - (29%)
Similarity:118/248 - (47%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQ 101
            ||..|..|.....|::..|.  ...:::|.|::|.|.:|||||||...:..:|:..|.|     .
  Fly    41 RIIGGSDAEITSHPWMAYLY--NEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGS-----G 98

  Fly   102 YTHWVGS-----------GNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVEL---PSYNDR 151
            .|...||           ...::|.::....:.|||::||... |.|:..:..:.:   |:....
  Fly    99 LTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLL 163

  Fly   152 YQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSW--SLHDNMICINTNGGK--ST 212
            .:|  |...:|:|| |..|....|..||...:.:|:::.||:.:  ::....||.   |.|  :|
  Fly   164 LED--GMTLMATGW-GLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICA---GDKETNT 222

  Fly   213 CGGDSGGPL---VTHEGN-RLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |.|||||||   |.:.|: |.|  |:||| ....|:|  |::::.::.|..||
  Fly   223 CLGDSGGPLGGVVNYYGDLRFVQYGITSF-GDIECRS--PSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 70/246 (28%)
Tryp_SPc 38..262 CDD:238113 71/247 (29%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 70/246 (28%)
Tryp_SPc 42..275 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.