DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CG43125

DIOPT Version :10

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:43/86 - (50%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYG---ASLRNQP--QYTHWVGSG 109
            |::|.:....:.|..|.|::|...:|||||.|.:..:.:.:..|   .:|:|..  ||.. :...
  Fly    37 PWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEE-IYVA 100

  Fly   110 NFVQHHHYNSGNLHNDISLIR 130
            ..:.|..|:|.:...:|:|:|
  Fly   101 RALIHRSYSSESHQYNIALLR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 38..262 CDD:238113 23/86 (27%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 23/86 (27%)

Return to query results.
Submit another query.