DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Ctrl

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:255 Identity:86/255 - (33%)
Similarity:128/255 - (50%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHC--TNGASG 87
            ||.....:....||.||..|..|..|:.|.|. ...|..:||||:|...||:|||||  |.|...
  Rat    21 VPAITPALSYNQRIVNGENAVPGSWPWQVSLQ-DNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHF 84

  Fly    88 VTI-NYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR--TPHVDFWHLVNKVELPSYN 149
            |.: .|..|...:|  ...:.....:.|..:|...::||::|::  :| ..:...|:.|.|.|.|
  Rat    85 VILGEYDRSSNAEP--IQVLSISKAITHPSWNPNTMNNDLTLLKLASP-ARYTAQVSPVCLASSN 146

  Fly   150 DRYQDYAGWWAVASGWG---GTYDGSPLPDWLQAVDVQIMSQSDCSRSWS--LHDNMICINTNGG 209
            :...  ||...|.:|||   |.  |:..|..||.|.:.:::.:.|.:.|.  :.|:|||.. ..|
  Rat   147 EALP--AGLTCVTTGWGRISGV--GNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICAG-GAG 206

  Fly   210 KSTCGGDSGGPLVTHEGNR--LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGISY 267
            .|:|.||||||||..:||.  |:|:.|: .:..|...|||:::||:.:..||  |..|:|
  Rat   207 ASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTENCNVQAPAMYTRVSKFNTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 79/233 (34%)
Tryp_SPc 38..262 CDD:238113 80/235 (34%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 79/233 (34%)
Tryp_SPc 34..260 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.