DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and CTRC

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:176 Identity:46/176 - (26%)
Similarity:74/176 - (42%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIG 71
            ||.|::..:|:....|          ..|:..|..|.....|:.:.|.:..|..|  .|||::|.
Human    11 LACASSCGVPSFPPNL----------SARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIA 65

  Fly    72 NTWVLTAAHCTNGASGVTINYGASLRN-----QPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR- 130
            :.:|||||||.:......:..|   :|     ..:.:.:||......|..:|:..|.|||:||: 
Human    66 SNFVLTAAHCISNTRTYRVAVG---KNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKL 127

  Fly   131 TPHVDFWHLVNKVELPSYNDRY-QDYAGWWAVASGWGGTYDGSPLP 175
            ..||:....:....||..:... :||.   ...:|||..:.|...|
Human   128 AEHVELSDTIQVACLPEKDSLLPKDYP---CYVTGWGRLWRGLRWP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 41/148 (28%)
Tryp_SPc 38..262 CDD:238113 40/147 (27%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 39/139 (28%)
Tryp_SPc 30..>173 CDD:238113 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.