DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and cela1.2

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:282 Identity:82/282 - (29%)
Similarity:123/282 - (43%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGN--WWCGGSI 69
            |.|:|.|..|:..|..      :||:.|:.|:..|..|.....|:.:.|.:|..|.  ::|.|::
Zfish     5 LLLSVLATLALAEPRY------LKDIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGTL 63

  Fly    70 IGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTH-----WVGSGNFVQHHHYNSGNL--HNDIS 127
            |...||:.||||.......|:    :|.:...|||     ::.......|.::|..|:  ..||:
Zfish    64 IRPGWVMVAAHCVEALRKWTV----ALGDHDIYTHEGPEQYISVSEVFIHPNWNPNNVAFGYDIA 124

  Fly   128 LIR-------TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQI 185
            |:|       :.:|....|.:..|:..|        |.....:|||.|..|..|...|:...:.:
Zfish   125 LLRLSIDATLSSYVQVATLPSSGEILPY--------GHTCYITGWGYTETGGSLSAQLKQAYMPV 181

  Fly   186 MSQSDCS-RSW---SLHDNMICINTNGGKSTCGGDSGGPL--------VTHEGNRLVGVTSFVSS 238
            :....|| :.|   |:.:.|||.......|.|.||||.||        |.|      |||||||.
Zfish   182 VDYETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVH------GVTSFVSP 240

  Fly   239 AGCQS-GAPAVFSRVTGYLDWI 259
            .||.: ..|..|:||:.|::||
Zfish   241 EGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 71/250 (28%)
Tryp_SPc 38..262 CDD:238113 72/251 (29%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 71/250 (28%)
Tryp_SPc 30..265 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.