DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fii and Tpsab1

DIOPT Version :9

Sequence 1:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:244 Identity:81/244 - (33%)
Similarity:110/244 - (45%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITNGYPAYEGKVPYIVGLLFSGNGNWW---CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQ 99
            |..|..|:..|.|:.|.|  ..|..:|   ||||:|...||||||||..............||.|
Mouse    29 IVGGQEAHGNKWPWQVSL--RANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKVRVQLRKQ 91

  Fly   100 PQY--THWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAV 161
            ..|  .|.:.....:.|..:.......||:|:: |..|:....|:.|.||..::.:......|  
Mouse    92 YLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCW-- 154

  Fly   162 ASGWGGTYDG--SPLPDWLQAVDVQIMSQSDCSRSW--------SLH---DNMICINTNGGKSTC 213
            .:|||...:|  .|.|..|:.|.|.|:....|...:        ::|   |:|:|.. |.|..:|
Mouse   155 VTGWGNIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAG-NEGHDSC 218

  Fly   214 GGDSGGPLVTH-EGNRL-VGVTSFVSSAGC-QSGAPAVFSRVTGYLDWI 259
            .||||||||.. |...| .||.|:  ..|| |...|.:::|||.|||||
Mouse   219 QGDSGGPLVCKVEDTWLQAGVVSW--GEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 79/242 (33%)
Tryp_SPc 38..262 CDD:238113 81/244 (33%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 81/244 (33%)
Tryp_SPc 29..265 CDD:214473 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.