DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT1G20270

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:237 Identity:78/237 - (32%)
Similarity:120/237 - (50%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SPSDLRSLRCRYVTNRVPFL-RLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATV 376
            ||.||...| |..|.|...| :.|....|.:..:|...:||:.:...|.:.:..:|:|...::||
plant    50 SPIDLSYFR-RAATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTV 113

  Fly   377 QNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHF 441
            .:|.||..:.:..|.|...:|:...|::|:|:.:|.||.|.:..|..|.|||::|..|..||||:
plant   114 VDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHY 178

  Fly   442 DFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVFTSLH-------------------TALF 487
            |:...|    |...|.|.|:||:|.|:||||:||.|||.:.:                   .::.
plant   179 DYFVDE----FNTKNGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVK 239

  Fly   488 PKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIH 529
            |:.|.|..:.::..|...|..:.|..|||:.|.||.|.||:|
plant   240 PRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWMH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 63/191 (33%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 67/207 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.