DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT4G35820

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:299 Identity:80/299 - (26%)
Similarity:141/299 - (47%) Gaps:58/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SALTMTNELLQLLPHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDM 296
            |..|..:.:|.|   .:|..|.|.:...::.|.:.    ..|:...|....|:.:          
plant     2 SKSTSVSTILYL---RQRLQGLKIYETSDLIQHIN----TFDELVGEQVSVDVKI---------- 49

  Fly   297 TERRAYEMLCRGELKPSPSDLRSLRCRYV----TNRVPFLRLGPLKLEEVHADPYIVIYHD--AM 355
             |.:..:|:....|.|.   |.:|.|..|    :.|.|..|.    ||.:..:|...:||:  |:
plant    50 -EEKTKDMILLCSLSPL---LTTLTCSMVKVAASLRFPNERW----LEVITKEPRAFVYHNFLAL 106

  Fly   356 Y------DSEIDLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTAD 414
            :      :.|.|.:..:|:|...|:.|:|::||..|.::.|.|...::::..|::::.:.:|.::
plant   107 FFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKIVKEIEKRISE 171

  Fly   415 MTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVF 479
            .|.:..::.|.|||:||.:|..:|||||        .|:      ||||||.|:|||::||.|||
plant   172 FTFIPQENGETLQVINYEVGQKFEPHFD--------GFQ------RIATVLMYLSDVDKGGETVF 222

  Fly   480 -------TSLHTALFPKKGTAAFWMNLHRDGQGDVRTRH 511
                   :....::.||||.|..:.::..||..|..::|
plant   223 PEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 52/169 (31%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 18/94 (19%)
P4Hc 115..262 CDD:214780 52/161 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.