DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT4G35810

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:213 Identity:65/213 - (30%)
Similarity:104/213 - (48%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 LEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLKTQEDR 403
            ||.:..:|...:||:.:.:.|.:.:..:|:|...::.|.:..||....:..|.|...:|....|.
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   404 VIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNL---GNRIATVL 465
            ::|.:..|.:|.|.:..::.|.|||::|.:|..||||.|:       .|:..|:   |.||||||
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDY-------FFDEFNVRKGGQRIATVL 202

  Fly   466 FYMSDVEQGGATVFTSLH-------------------TALFPKKGTAAFWMNLHRDGQGDVRTRH 511
            .|:|||::||.|||.:..                   .::.|||..|..:.::..|...|..:.|
plant   203 MYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLH 267

  Fly   512 AACPVLTGTKWVSNKWIH 529
            ..|||:.|.||.|.||.|
plant   268 GGCPVIKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 59/194 (30%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 65/213 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.