DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT4G33910

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:169 Identity:47/169 - (27%)
Similarity:76/169 - (44%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 ALETANYRISKSAWLKTQEDR--VIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFAR 445
            |..|...|.|...::...|:.  .::.|.::.|..|.:.....|...::.|.:|..|:.|:|...
plant   123 AENTKGTRTSSGTFISASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYDSHYDVFN 187

  Fly   446 KEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVF---------------TSLHTALFPKKGTAAF 495
            ..|.    |.....|||:.|.|:||||:||.|:|               ..:...:.|:||....
plant   188 PTEY----GPQSSQRIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLL 248

  Fly   496 WMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQE 534
            :.::..:|..|..:.|.:|||..|.|||:.|||.::.||
plant   249 FYSVFPNGTIDQTSLHGSCPVTKGEKWVATKWIRDQDQE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 44/162 (27%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 45/167 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.