DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT3G28480

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:226 Identity:66/226 - (29%)
Similarity:113/226 - (50%) Gaps:32/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALETANYRIS----KSAW 396
            |.::.::...|.:.:|...:.|.|.|...::|:.:..::.|.::.:|....:...:|    .|::
plant    53 PTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVESEDSVSVVRQSSSF 117

  Fly   397 LKTQE----DRVIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNL 457
            :...:    |.::..|..:.|..|.|..::.|.:|:::|..|..||||||:...:     ..|.|
plant   118 IANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYFHDQ-----ANLEL 177

  Fly   458 -GNRIATVLFYMSDVEQGGATVF-------TSLHT-----------ALFPKKGTAAFWMNLHRDG 503
             |:||||||.|:|:||:||.|||       |.|..           |:.|:||.|..:.|||.:.
plant   178 GGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPNA 242

  Fly   504 QGDVRTRHAACPVLTGTKWVSNKWIHERGQE 534
            ..|..:.|.:|||:.|.||.:.:|||.:..|
plant   243 TTDSNSLHGSCPVVEGEKWSATRWIHVKSFE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 60/199 (30%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 66/226 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.