DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and P4H2

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:220 Identity:64/220 - (29%)
Similarity:108/220 - (49%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 LGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLK 398
            :.|.|:::|.:.|...:|...:.|.|.|.:..:|:...:|:.|.::..|..:.::.|.|...::.
plant    33 INPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSSGTFIS 97

  Fly   399 TQEDRVIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNL---GNR 460
            ..:|.::..:..:.:..|.|..::.|:|||:.|..|..|:.|||:..       :.:|:   |:|
plant    98 KGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFH-------DKVNIARGGHR 155

  Fly   461 IATVLFYMSDVEQGGATVFTSLH---------------------TALFPKKGTAAFWMNLHRDGQ 504
            |||||.|:|:|.:||.|||....                     .|:.||||.|..:.||.:|..
plant   156 IATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAI 220

  Fly   505 GDVRTRHAACPVLTGTKWVSNKWIH 529
            .|..:.|..|||:.|.||.:.||||
plant   221 PDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 57/196 (29%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 57/196 (29%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.