DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:247 Identity:73/247 - (29%)
Similarity:119/247 - (48%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 PSPSDLRSLRCRYVTN--------RVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMAR 368
            ||...||....||:.:        ....||:|.:|.|.|...|.|::.||.:...|.:.:|.:||
plant    42 PSLRGLRGQNTRYLRDVSRWANDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIAR 106

  Fly   369 PRFRRATVQNSVTGALETANYRISKSAWLKTQEDR---VIETVVQRTADMTGLDMDSAEELQVVN 430
            ||.:.:||.:..||....::.|.|...:| |..:|   :|:.:.:|.|..:.:..::.|.:||:.
plant   107 PRLQVSTVVDVKTGKGVKSDVRTSSGMFL-THVERSYPIIQAIEKRIAVFSQVPAENGELIQVLR 170

  Fly   431 YGIGGHYEPHFDFARKEEQRAFEGLNL---GNRIATVLFYMSDVEQGGATVF------------- 479
            |.....|:||.|:..       :..||   |.|:||:|.|::|..:||.|.|             
plant   171 YEPQQFYKPHHDYFA-------DTFNLKRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGK 228

  Fly   480 TSLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHER 531
            .....::.|.||.|..:.::..|||.|.|:.|..|.||:|.||.:.||:.::
plant   229 IMKGISVKPTKGDAVLFWSMGLDGQSDPRSIHGGCEVLSGEKWSATKWMRQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 57/191 (30%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 62/209 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.