DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and P4H13

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:184 Identity:54/184 - (29%)
Similarity:86/184 - (46%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 MARPRFRRATVQNSVTGALETA-NYRISKSAWLKTQEDR--VIETVVQRTADMTGLDMDSAEELQ 427
            ||:|:.:.:|:........||. |||   |....|.||.  |:..:.::.|..|....|..|...
plant    95 MAKPKLKPSTLALRKGETAETTQNYR---SLHQHTDEDESGVLAAIEEKIALATRFPKDYYESFN 156

  Fly   428 VVNYGIGGHYEPHFDFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVF------------- 479
            ::.|.:|..|:.|:|.....|.    |..:..|:.|.|.::|.||:||.|:|             
plant   157 ILRYQLGQKYDSHYDAFHSAEY----GPLISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYD 217

  Fly   480 --TSLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHER 531
              ..:...:.|::|.|.|:.||..:|..|..:.|.:|||:.|.|||:.|||.::
plant   218 YEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVATKWIRDQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 53/180 (29%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 53/180 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.