DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and p4htmb

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:341 Identity:86/341 - (25%)
Similarity:132/341 - (38%) Gaps:103/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 EKEIAQQLQLRKMKG--------DDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELKPSP 314
            |:|.|..::|.::||        .:|.:|:   |..:..|...||:..:...     .|:|:|. 
Zfish   166 EEECAVVVRLAQLKGLMESQVMVPEGQEEL---DQQLNLSPEEIFNFLDLNQ-----DGQLQPH- 221

  Fly   315 SDLRSLRCR---YVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDS-----------EIDLIKR 365
            ..|...|.|   ::|:.         .|:|:             ||.           .::...|
Zfish   222 EILTHSRVRDGIWLTSE---------NLKEI-------------YDGLKADLDGNGLLSLEEFGR 264

  Fly   366 MARPRFRRATVQNSVTGALETANYRISKSAWLKTQE--DRVIETVVQRTADMTGLD---MDSAEE 425
            :....|:|..:|..|..:....|   |:..||...:  .:|::.:.:|...:|.|.   ::.:|.
Zfish   265 LRSDAFQRFLLQRGVERSQLVRN---SRHTWLYQGQGAHQVLQDLRKRVTLLTRLPSSLVELSEP 326

  Fly   426 LQVVNYGIGGHYEPHFDFARKEEQRAFEGLNLGN----------RIATVLFYMSDVEQGGATVF- 479
            ||||.|..||||..|.|......:.|.....|..          |..|||||:::|::||.|.| 
Zfish   327 LQVVRYEQGGHYHAHHDSGPVYPETACTHTRLAANTTSPFQTSCRYITVLFYLNNVQEGGETTFP 391

  Fly   480 ---------------------TSLH-----TALFPKKGTAAFWMNLHRDGQG-----DVRTRHAA 513
                                 |..|     ..:.|.||||.||.|...||:|     |..:.|..
Zfish   392 VADNRTYEEASLIQNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLHGG 456

  Fly   514 CPVLTGTKWVSNKWIH 529
            |.|..|||||:|.||:
Zfish   457 CVVTQGTKWVANNWIN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 64/230 (28%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 13/85 (15%)
EFh 204..262 CDD:298682 13/85 (15%)
P4Hc 285..471 CDD:214780 56/188 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.