DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and P4HTM

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:394 Identity:91/394 - (23%)
Similarity:127/394 - (32%) Gaps:148/394 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 EKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELKPSPSDLRSLRC 322
            ::|....:.|.:|||...:..:|..:...|.|...:..:...|..:....|.|:     ||.:..
Human   153 DEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQLDLFRLLDQNRDGHLQ-----LREVLA 212

  Fly   323 RYVTNRVPFLRLG------PLKLEEVHADPYIVIYHDAMYD--------SEIDLIKRMARPRFRR 373
            :        .|||      |..::|:    |..|..|...|        |.:||.......|..:
Human   213 Q--------TRLGNGWWMTPESIQEM----YAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHK 265

  Fly   374 ATVQNSVTGALETANYRISKSAWLKTQE--DRVIETVVQRTADMTGLD---MDSAEELQVVNYGI 433
            |.....|         |.|...||...|  ..::..:.||...:|.|.   ::.:|.||||.||.
Human   266 AESSELV---------RNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGE 321

  Fly   434 GGHYEPHFDFAR-------------KEEQRAFE------------------------------GL 455
            ||||..|.|...             ..|...||                              |:
Human   322 GGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTPMTQAQPCTVGV 386

  Fly   456 NLG----------------------------NRIATVLFYMSDVEQGGATVF------------- 479
            .||                            ....|||||:::|..||.|||             
Human   387 PLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMSL 451

  Fly   480 ---------TSLH-----TALFPKKGTAAFWMNLHRDGQG-----DVRTRHAACPVLTGTKWVSN 525
                     |..|     ..:.|::|||.||.|...||||     |..:.|..|.|..||||::|
Human   452 IQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIAN 516

  Fly   526 KWIH 529
            .||:
Human   517 NWIN 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 69/288 (24%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 15/76 (20%)
EFh 194..252 CDD:238008 15/74 (20%)
P4Hc 246..519 CDD:214780 67/281 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.