DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and CG4174

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:528 Identity:133/528 - (25%)
Similarity:228/528 - (43%) Gaps:87/528 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VGGPANGEVYTALAEMEELLETESVL---------ITNLEGYIRVQEDKLNFLKNKMDEYQREHS 72
            :|....|||.:|....:..:.:||.|         :.||:.|.:|       ||..:.:.:|...
  Fly    12 LGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKV-------LKKHLQKIRRAIR 69

  Fly    73 DASHDITAYVSNPIN---AYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLL-KFPSDEDL 133
            .:...:.:..::|.|   .|.:.:.|..||.|...|::.|:|   |:.|...:.|| :.|:..|.
  Fly    70 QSEELLKSTKTSPRNLIYGYKVLRHLHNDWPQYFRLLKKDLG---LEQIAVSQMLLTQQPTSVDF 131

  Fly   134 NGAAVALLRLQDTYQLDTSSVARGKLNGIQYS-TEMSSDDCFELGRQSYVNHDYYHTVLWMNEAM 197
            ..:..|:.|||..|.||:.::..|.::....: ...|:|:|..||.......||..:..|:..|:
  Fly   132 EESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELAL 196

  Fly   198 ARMLEEPTNHT---QSFTKADILEYLAFSTYKEGNIESALTMTNELLQLLPHHERANGNKRFYEK 259
            ....:..:...   :.:...::||.|..:....|:...|....||||.:.|:|...         
  Fly   197 YHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYM--------- 252

  Fly   260 EIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELKPSPSDLRSLRCRY 324
             :.|..:|:.::.:......||....:.|.   |.....||...:|.               |||
  Fly   253 -LTQLPKLKHLQSNPAKLTKPKKVFQLQKE---ICSKRYRRKSGVLV---------------CRY 298

  Fly   325 VTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALETANY 389
            | :..|||:|.|||:||:...|||.|::..:...:|:::|.::||:.:|          :|..:.
  Fly   299 V-DWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQR----------IEHLSG 352

  Fly   390 RIS-KSAWLKTQEDRVIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQRAFE 453
            ..| |...|.|....|:..|.:....:||..:...:.|:|:||||.|:|.|       ||.:   
  Fly   353 NCSCKIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNP-------EEPK--- 407

  Fly   454 GLNLGNRIATVLFYMSDVEQGGATVFTSLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLT 518
               :.|: |....::|:..:||..||.|.|..:.|:||:...|.||.:.      ..:..||:|.
  Fly   408 ---IHNK-ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKS------LIYHQCPILK 462

  Fly   519 GTKWVSNK 526
            |..||:||
  Fly   463 GNMWVANK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528 35/143 (24%)
P4Hc 356..529 CDD:214780 48/172 (28%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 34/133 (26%)
TPR repeat 169..197 CDD:276809 8/27 (30%)
TPR repeat 202..245 CDD:276809 9/42 (21%)
2OG-FeII_Oxy <362..470 CDD:304390 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.