DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and CG34041

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:368 Identity:82/368 - (22%)
Similarity:145/368 - (39%) Gaps:59/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MLLLGILLLVGGPANGEVYTALAEME--ELLETESVLITNLEGYIRVQEDKLNFLKNKMDEYQRE 70
            :|.:|::::....:|.|...:|::.:  .:|:.:..::..||.||...|.||..:...:.:....
  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302

  Fly    71 HSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLLKFPSDEDLNG 135
            |.....|..|..|:|:.:|.|...:.:||...:..::.|.|.|.|.::...:..|  |:..|::.
  Fly   303 HIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYL--PTKNDISE 365

  Fly   136 AAVALLRLQDTYQLDTSSVARGKLNGIQ--YSTE-----------------MSSDDCFELGRQSY 181
            ....:.::.:.|.:....:|.|.:.|.|  |.:.                 ||..||..|...|.
  Fly   366 VCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSM 430

  Fly   182 VNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNELLQLLPH 246
            ...||..:..|:|.|:: |||...........||:...||....|:.|...||......|:..|.
  Fly   431 EMKDYNKSKEWLNVAIS-MLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPR 494

  Fly   247 HERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELK 311
                |......:|.::..:.|       |..:.||.::             |...|.:...|   
  Fly   495 ----NAQLIRMQKRLSYHILL-------GPPKSPKLNI-------------ENNDYRLRKNG--- 532

  Fly   312 PSPSDLRSLRCRYVTN-RVPFLRLGPLKLEEVHADPYIVIYHD 353
                   ||.|.|.|. |..:..|.|:|.|.:..||.:::||:
  Fly   533 -------SLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528 28/132 (21%)
P4Hc 356..529 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 27/130 (21%)
TPR repeat 452..491 CDD:276809 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.