DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and P4htm

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:406 Identity:101/406 - (24%)
Similarity:136/406 - (33%) Gaps:159/406 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 IAQQLQLRKMKGDDGTDEMP----KSDLPVAKSDPAIFDMT---------ERRAYEMLCRG---- 308
            :|..|.:....||:.||..|    :|..||    |.:..:|         ||:...:..|.    
  Rat    77 LALLLFVHYSNGDESTDPGPQRREQSPQPV----PTLGPLTRLEGIKVGYERKVQVVAGRDHFIR 137

  Fly   309 --ELKP----SPSDLRSLRCRYVTNRVPFLRLGPLK---------LEEVHADPYIVIYHDAM--- 355
              .|||    .|..|....||.:      :.|..:|         .||         |.:||   
  Rat   138 TLSLKPLLFEIPGFLSDEECRLI------IHLAQMKGLQRSQILPTEE---------YEEAMSAM 187

  Fly   356 --------------YDSEIDLIKRMARPRF---RRATVQN---------------SVTGALETAN 388
                          :|..:.|.:.:|:.|.   |..|.:|               .|....|.:|
  Rat   188 RVSQLDLFQLLDQNHDGRLQLREVLAQTRLGNGRWMTPENIQEMYSAIKADPDGDGVLSLQEFSN 252

  Fly   389 --------------------YRISKSAWLKTQE--DRVIETVVQRTADMTGLD---MDSAEELQV 428
                                .|.|...||...|  ..|:..:.||...:|.|.   ::.:|.|||
  Rat   253 MDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQV 317

  Fly   429 VNYGIGGHYEPHFDFAR-------------KEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVF- 479
            |.||.||||..|.|...             ..|...||   ...|..|||||:::|..||.||| 
  Rat   318 VRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFE---TSCRYMTVLFYLNNVTGGGETVFP 379

  Fly   480 ---------------------TSLH-----TALFPKKGTAAFWMNLHRDGQG-----DVRTRHAA 513
                                 |..|     ..:.|::|||.||.|...||||     |..:.|..
  Rat   380 VADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGG 444

  Fly   514 CPVLTGTKWVSNKWIH 529
            |.|..||||::|.||:
  Rat   445 CLVTRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 71/260 (27%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 9/59 (15%)
P4Hc 247..459 CDD:214780 62/214 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.