DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and phy-4

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:238 Identity:71/238 - (29%)
Similarity:119/238 - (50%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CRGELKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPR 370
            |..||:...|....|.| |..::...:|    |:|.:.::|:|:.||:.::       :|:|:..
 Worm    36 CGKELRGDSSRDGRLVC-YRLHKHLLIR----KVEILSSEPFILQYHNQVH-------RRLAKRA 88

  Fly   371 FRRATV----QNSVTG---ALETANYRISKSAWL----KTQEDRVIETVVQRTADMTGLDMDSAE 424
            .:.|..    |..::|   ..|.:..|.:...||    :....|:.|.:   .|::..||:.:||
 Worm    89 VQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARIFEGL---QANINSLDLSTAE 150

  Fly   425 ELQVVNYGIGGHYEPHFDFARKEEQ-RAFEGLNLGNRIATVLFYMSDVEQGGATVFTSLHTALFP 488
            ..|:::|...|:|.||:|:...... :..||  .||||||||..:...::||.|||..|:..:.|
 Worm   151 PWQILSYNADGYYAPHYDYLNPATNVQLVEG--RGNRIATVLVILQIAKKGGTTVFPRLNLNIRP 213

  Fly   489 KKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHER 531
            |.|....|:|....|:.:.:|.|||||:..|||..:..|:||:
 Worm   214 KAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWVHEK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 55/184 (30%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 55/184 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3137
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.