DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaEFB and phy-3

DIOPT Version :9

Sequence 1:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:233 Identity:61/233 - (26%)
Similarity:107/233 - (45%) Gaps:11/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LCRGELKPSPSDLRSLRC-RYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMAR 368
            ||..|.|.:........| .||.|.:      |:.:|.:...|.:|||.:.|...:.........
 Worm    56 LCDDETKDTKWQKNDSICITYVYNML------PVDMEIISWAPTLVIYRNLMSPRQTASFLNFIE 114

  Fly   369 PRFRRATVQNSVTGALETANYRISKSAWLKTQEDRV-IETVVQRTADMTGLDMDSAEELQVVNYG 432
            .|.......:....::|| .:|.:..:::..::..| :|..:|....:.||::..||....::|.
 Worm   115 QRDLEIQKTSDFGTSIET-THRRANGSFIPPEDSNVTVEIKMQAQKRIPGLNLTVAEHFSALSYL 178

  Fly   433 IGGHYEPHFDFARKEEQRAFE-GLN-LGNRIATVLFYMSDVEQGGATVFTSLHTALFPKKGTAAF 495
            .||||..|:|:.....::.:: .:| .||||.|::|.:...|:||.|||.|:.:.:....|.|.|
 Worm   179 PGGHYAVHYDYLDYRSKQDYDWWMNKTGNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFF 243

  Fly   496 WMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQ 533
            |.|...|.:.::.:.|..||:..|.|.::..||....|
 Worm   244 WFNAQADEEKEMLSNHGGCPIYEGRKVIATIWIRAYNQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528
P4Hc 356..529 CDD:214780 44/175 (25%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 44/175 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3137
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.