DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDase and ASAH2B

DIOPT Version :9

Sequence 1:NP_001263109.1 Gene:CDase / 43618 FlyBaseID:FBgn0039774 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001072984.1 Gene:ASAH2B / 653308 HGNCID:23456 Length:165 Species:Homo sapiens


Alignment Length:189 Identity:54/189 - (28%)
Similarity:82/189 - (43%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 FGPHTHSIYMDVF---ERLTKAMMRNETVDAGPSPPYMNDVMLSLNTGVLFDGHPINTDFGYVKS 589
            |...||  |:..|   |.|.:.::|  .||..|......||:                       
Human     7 FMDRTH--YLLTFSSSETLLRLLLR--IVDRAPKGRTFGDVL----------------------- 44

  Fly   590 QPNK-EYGINETVKVTYISGNPRNNL--FTEKTYFTIER-KINEDRWKVAYTDASWETKMVWHRT 650
            ||.| ||.:.|..:|.::..||:|::  .|.:|:.|:|: :.....|::...||||||:..||: 
Human    45 QPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHK- 108

  Fly   651 NTILGFSEMDIYWDISPQTLPGEYRIRHSGEYK--------YILGGKYPYEGLTHSFTV 701
             .:||.|...:.|.|.....||.||||:.|..:        .||.    :||.:.:|.|
Human   109 -GLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILS----FEGTSPAFEV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDaseNP_001263109.1 PTZ00487 24..701 CDD:240437 53/187 (28%)
Ceramidase_alk 25..538 CDD:282576 4/9 (44%)
Ceramidse_alk_C 540..701 CDD:293653 49/175 (28%)
ASAH2BNP_001072984.1 Ceramidse_alk_C <30..162 CDD:407221 45/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141661
Domainoid 1 1.000 84 1.000 Domainoid score I8254
eggNOG 1 0.900 - - E1_KOG2232
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118111at33208
OrthoFinder 1 1.000 - - FOG0003346
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.