DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and RPN8

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_014904.3 Gene:RPN8 / 854435 SGDID:S000005787 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:74 Identity:15/74 - (20%)
Similarity:32/74 - (43%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TSKNIETCGVLAGHLSQNQLYITH-IITPQQQGTPDSCNT----MHEEQIFDVQDQMQLIT---- 323
            |.:|....||:.|..:.:.:.:|: ...|.::   |..|:    :....|.::.:..:.|.    
Yeast    27 TKENKRCVGVILGDANSSTIRVTNSFALPFEE---DEKNSDVWFLDHNYIENMNEMCKKINAKEK 88

  Fly   324 -LGWIHTHP 331
             :||.|:.|
Yeast    89 LIGWYHSGP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 15/74 (20%)
RPN8NP_014904.3 MPN_RPN7_8 6..303 CDD:163693 15/74 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.