DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and RPN11

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_116659.1 Gene:RPN11 / 850554 SGDID:S000001900 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:34/135 - (25%)
Similarity:67/135 - (49%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 DTME-VFL-KLALANTSKN------IETCGVLAGH-LSQNQLYITHIITPQQQGT---PDSCNTM 307
            ||.| |:: .:||....|:      :|..|::.|. :....:.:..:....|.||   .::.:.:
Yeast    22 DTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDV 86

  Fly   308 HEEQIFDV-----QDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTT 367
            .:.::.|:     :|||   .:||.|:||....:|||||::|..|::.:...|:|:|..|..:..
Yeast    87 FQAKMMDMLKQTGRDQM---VVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVK 148

  Fly   368 GFFIL 372
            |..::
Yeast   149 GKVVI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 34/135 (25%)
RPN11NP_116659.1 MPN_RPN11_CSN5 22..282 CDD:163700 34/135 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.