DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and MPND

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001287791.1 Gene:MPND / 84954 HGNCID:25934 Length:501 Species:Homo sapiens


Alignment Length:251 Identity:56/251 - (22%)
Similarity:88/251 - (35%) Gaps:72/251 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TGANRSLPGSG----LLLPAASE------AAADKT------TNSKPSFDRNQKPSYNRTDS---- 241
            |.|:.|....|    ||:....|      :|.||:      :.|:|:......|. .|.||    
Human   173 TAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPG-KRVDSKIRV 236

  Fly   242 ----LLAGSLRLVYVPGDTMEVFLKLALAN--------TSKNI-------------ETCGVLAGH 281
                .:.||..|...|...:|| ...|..|        .|.|:             |..|.|.|.
Human   237 PVRYCMLGSRDLARNPHTLVEV-TSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGR 300

  Fly   282 LSQNQLYITHIIT---PQQQGTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLH 343
            ...|...:|.:..   ..:.|..::...: ||:|:.......|..:||.|:||...|..|..|:.
Human   301 WDVNSQMLTVLRAFPCRSRLGDAETAAAI-EEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDID 364

  Fly   344 THCSYQIMM-------PEALAIVCAPKYN--------TTGFFILTP------HYGL 378
            ....||:.:       ...||::|:|.|:        .:.|:::.|      .||:
Human   365 AQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEQRPSDYGI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 38/177 (21%)
MPNDNP_001287791.1 MPN_2A_DUB 266..450 CDD:163698 32/156 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.