DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and CSN6B

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_567746.1 Gene:CSN6B / 828749 AraportID:AT4G26430 Length:317 Species:Arabidopsis thaliana


Alignment Length:182 Identity:40/182 - (21%)
Similarity:62/182 - (34%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTMHEEQIFD----------VQDQ 318
            |..|.|.|.:..      |.||......:|..|:..|.:..|:.  |.|||          ::.:
plant    40 ATGNGSNNADAM------LLQNPRVYGCVIGLQRGRTVEIFNSF--ELIFDPALDTLDRSFLEKK 96

  Fly   319 MQL--------ITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFFILTPH 375
            .:|        ..|||..|....|    ..|:|.|.:...:....:.::..|..|         |
plant    97 QELYKKVFPDFYVLGWYSTGSDAT----ESDMHIHKALMDINESPVYVLLNPAIN---------H 148

  Fly   376 YGLDYIAQCRQSGFHPHPNDP-PLF---------MEAQHIRMDNQAKIKVID 417
            ...|......:|.||.....| .:|         :||:.|.:|:.|.:|..|
plant   149 AQKDLPVTIYESEFHVIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 40/182 (22%)
CSN6BNP_567746.1 MPN_CSN6 9..310 CDD:163694 40/182 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.