DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and Stambp

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001349007.1 Gene:Stambp / 70527 MGIID:1917777 Length:424 Species:Mus musculus


Alignment Length:443 Identity:191/443 - (43%)
Similarity:265/443 - (59%) Gaps:57/443 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDVE--PQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTL 73
            |||.  ||:|::.||..|:.:|:::::|..||||||.|::|||:||..|||.|:|||||.:|:||
Mouse     5 GDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAFILYNKYITL 69

  Fly    74 FIEKIRQHPDYGS-VKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQFLASKEAERVKELE 137
            ||||:.:|.||.| :..|.:|..:|:|....|..|:|:.:||..|.:||||:...|:.|. :||.
Mouse    70 FIEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQYKERKKKEE-EELA 133

  Fly   138 R------ERERERER---QRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSAPDLGLLDQVVYPN 193
            |      |.|:|::|   |:||:.|:....|...:|...   .:::.......:.|.:|      
Mouse   134 RNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQ---ELEKERLKIVQEFGKVD------ 189

  Fly   194 DFPTGANRSLPG-SGLLLPAASEAAADKTTNS------------------KPSFDRNQKP---SY 236
                      || .|.|||...:...|...:|                  .|..||:.||   |.
Mouse   190 ----------PGPCGPLLPDLEKPCVDVAPSSPFSPTQTPDCNTGMRPAKPPVVDRSLKPGALSV 244

  Fly   237 NRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTP 301
            ......:.| ||.:.||.:....||:||.|||:|.|||||||.|.|.:|:..|||::.|:|.|.|
Mouse   245 IENVPTIEG-LRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVLIPRQNGGP 308

  Fly   302 DSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNT 366
            |.|:|.:||:||.:||.:.|:|||||||||||||||||||||||||||:|:||::||||:||:..
Mouse   309 DYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQE 373

  Fly   367 TGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            ||||.|| .|||..|:.|||.|||||..|||||.:..|:.:.::. :.:.|||
Mouse   374 TGFFKLT-DYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRI-VTITDLR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 49/103 (48%)
MPN_AMSH_like 247..419 CDD:163697 100/171 (58%)
StambpNP_001349007.1 Interaction with CHMP3. /evidence=ECO:0000250 1..127 58/121 (48%)
USP8_dimer 8..114 CDD:370218 49/105 (47%)
Interaction with STAM1. /evidence=ECO:0000250 227..231 0/3 (0%)
MPN_AMSH_like 254..424 CDD:163697 100/171 (58%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 12/12 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836833
Domainoid 1 1.000 147 1.000 Domainoid score I4492
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4719
Inparanoid 1 1.050 326 1.000 Inparanoid score I2459
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49824
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002716
OrthoInspector 1 1.000 - - otm43492
orthoMCL 1 0.900 - - OOG6_103166
Panther 1 1.100 - - LDO PTHR12947
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1402
SonicParanoid 1 1.000 - - X1584
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.