DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and mysm1

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_021324132.1 Gene:mysm1 / 561225 ZFINID:ZDB-GENE-041014-28 Length:828 Species:Danio rerio


Alignment Length:380 Identity:84/380 - (22%)
Similarity:130/380 - (34%) Gaps:134/380 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 EYEQFLASK--EAERV-KELERERERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQ---- 177
            |.|..||.|  .||.: :|:|.:.|.|.|..|..|:|          :..:|:.:.:|..|    
Zfish   289 EEETELADKCESAECLEEEVEDQEEDEEEELRAPEQE----------VELDLNTITEEEKQAISE 343

  Fly   178 -----PS-APDLGL------LDQVVYPNDFPTGANRSLPGSGLL----------------LPAAS 214
                 || .|:..|      |||  :....|...|::....||.                |..|.
Zfish   344 FFEGRPSKTPERYLKIRNYILDQ--WRRSKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAI 406

  Fly   215 EAAADKTTNSKPSF-DRNQ----KPSY------NRTDSLLAGSLRLVYVPGDTMEVFLKLALANT 268
            ....|:...::|.. ||::    |.|.      .|..|:.....|:..|.|:..:          
Zfish   407 NFNCDQAIYNRPRLVDRSRLKESKDSLEAYHLAQRLQSMRTRKRRIRDVWGNWCD---------- 461

  Fly   269 SKNIETCGVLAGHLSQNQLYITH----------IITPQQQGTPD-----SCNTMHEEQIFDVQDQ 318
            :|::|  |....|||..:|.|..          ...|:|:|:.|     .|.|..||:    |:.
Zfish   462 AKDLE--GQTYEHLSAEELAIRREEMKKKGPRPSKLPKQRGSFDPFQLIPCKTFGEER----QEP 520

  Fly   319 MQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMM----------PEALAIVCAPKYN--TTGFFI 371
            ..:|..         ...|..:|:|.|.|...::          .:.|.|..|...|  :||.  
Zfish   521 YSVIVC---------AEALIVMDIHAHVSMGEVIGLLGGTYEEEDKVLKICSAEPCNSLSTGL-- 574

  Fly   372 LTPHYGLDYIAQCRQS------------GFHPHPN-DP-PLFMEAQHIRMDNQAK 412
               ...:|.::|.:.|            .:|.||. || |...:     :|.|||
Zfish   575 ---QCEMDPVSQTQASEVLGVKGLSVVGWYHSHPAFDPNPSLRD-----IDTQAK 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 45/207 (22%)
mysm1XP_021324132.1 SANT 107..150 CDD:238096
SWIRM 331..408 CDD:309539 15/78 (19%)
MPN_2A_DUB 517..699 CDD:163698 26/128 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.