DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and CSN5

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster


Alignment Length:153 Identity:35/153 - (22%)
Similarity:56/153 - (36%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LKLAL-ANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCN---------TMHEEQIFDV 315
            ||:.: |.:...:|..|::.|.:..|.:.:........:||....|         |.:.|...:|
  Fly    60 LKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEV 124

  Fly   316 QDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTT------GFFILTP 374
            ......:  ||.|:||....:||.:|:.|....|......:|||..|....:      |.|...|
  Fly   125 GRMEHAV--GWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYP 187

  Fly   375 HYGLDYIAQCRQSGFHPHPNDPP 397
                        .|:.| ||:.|
  Fly   188 ------------KGYKP-PNEEP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 35/153 (23%)
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 35/153 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.