DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and Rpn11

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster


Alignment Length:149 Identity:33/149 - (22%)
Similarity:68/149 - (45%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 TDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGH-LSQNQLYITHIITPQQQGT-- 300
            ||:.:..:...||:....:...||...|...  :|..|::.|. :....:.:..:....|.||  
  Fly    18 TDAPVVDTAEQVYISSLALLKMLKHGRAGVP--MEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGV 80

  Fly   301 -PDSCNTMHEEQIFDV--QDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAP 362
             .::.:.:.:.::.|:  |.....:.:||.|:||....:||.||::|..|::.:...|:|:|..|
  Fly    81 SVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDP 145

  Fly   363 KYNTTG------FFILTPH 375
            ..:..|      |.::.|:
  Fly   146 IQSVKGKVVIDAFRLINPN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 31/141 (22%)
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 32/148 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.