DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and Psmd7

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001100896.1 Gene:Psmd7 / 307821 RGDID:1306902 Length:320 Species:Rattus norvegicus


Alignment Length:134 Identity:33/134 - (24%)
Similarity:62/134 - (46%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GTEMLRMAN-VYLREGNHENAFILYLRYMTLFIEK-------IRQH------------PDYGSVK 88
            ||...|:.| |:..:|  .|:.:|.:|   .::||       |..|            || .|::
  Rat   185 GTLSQRITNQVHGLKG--LNSKLLDIR---TYLEKVASGKLPINHHIIYQLQDVFNLLPD-ASLQ 243

  Fly    89 AEVRDINRKIKDE--IMPTTEKLRAKLLTHYQREYEQFLASKEAERVKELERERERERERQRQKE 151
            ..|:....|..|:  ::.....:|:.:..|  ......:|:::||: ||.:.:.|.::||:..||
  Rat   244 EFVKAFYLKTNDQMVVVYLASLIRSVVALH--NLINNKIANRDAEK-KEGQEKEESKKERKDDKE 305

  Fly   152 REKA 155
            :||:
  Rat   306 KEKS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 21/96 (22%)
MPN_AMSH_like 247..419 CDD:163697
Psmd7NP_001100896.1 MPN_RPN7_8 7..285 CDD:163693 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.