DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and Cops6

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001100599.1 Gene:Cops6 / 304343 RGDID:1309919 Length:344 Species:Rattus norvegicus


Alignment Length:269 Identity:51/269 - (18%)
Similarity:91/269 - (33%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNRTDSLLA----GSLRLVYVP---------- 253
            |.|:|.:..||:.|||.....:..|...:.........|::|    ||:.:...|          
  Rat     8 LAGAGKMAAAAAAAAAAAAAAANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHW 72

  Fly   254 -------GDTMEVFLKLALANTSKNIETCG--VLAGHLSQNQLYI--THIITPQQQ--------- 298
                   |..|:|...|......:|||...  .|..|..:.::.|  .:..|.::|         
  Rat    73 IRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEKKIIIDKEYYYTKEEQFKQVFKELE 137

  Fly   299 --------GTPDSCNTMHEEQIFDVQDQMQLITLGWI--HTHPTQTAFLSSVD--------LHTH 345
                    |.||..:....:|:.::.:....:.|..:  ||....:.|.|.:|        |...
  Rat   138 FLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAE 202

  Fly   346 CSYQIMMPEALAIVCAPKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQ 410
            .:|.:...||..|                  |:|::|:...:|...:..      .|:|:...:.
  Rat   203 LTYTLATEEAERI------------------GVDHVARMTATGSGENST------VAEHLIAQHS 243

  Fly   411 AKIKVIDLR 419
            | ||::..|
  Rat   244 A-IKMLHSR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 37/219 (17%)
Cops6NP_001100599.1 MPN_CSN6 56..338 CDD:163694 38/221 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.