DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and Cops6

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_036132.1 Gene:Cops6 / 26893 MGIID:1349439 Length:324 Species:Mus musculus


Alignment Length:253 Identity:49/253 - (19%)
Similarity:87/253 - (34%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 GANRSLPGSGLLLPAASEAAADKTTNSKPSFDRNQKPSYNRTDSLLAGSLRLVYVPGDTMEVFLK 262
            |||.|...||:.:.||..:..........|...:.....|.:|..    :|:....|..|:|...
Mouse     8 GANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHW----IRMRSQEGRPMQVIGA 68

  Fly   263 LALANTSKNIETCG--VLAGHLSQNQLYI--THIITPQQQ-----------------GTPDSCNT 306
            |......:|||...  .|..|..:.::.|  .:..|.::|                 |.||..:.
Mouse    69 LIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDI 133

  Fly   307 MHEEQIFDVQDQMQLITLGWI--HTHPTQTAFLSSVD--------LHTHCSYQIMMPEALAIVCA 361
            ...:|:.::.:....:.|..:  ||....:.|.|.:|        |....:|.:...||..|   
Mouse   134 HVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERI--- 195

  Fly   362 PKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
                           |:|::|:...:|...:..      .|:|:...:.| ||::..|
Mouse   196 ---------------GVDHVARMTATGSGENST------VAEHLIAQHSA-IKMLHSR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 37/202 (18%)
Cops6NP_036132.1 MPN_CSN6 36..318 CDD:163694 41/225 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.