DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and F37A4.5

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_498470.1 Gene:F37A4.5 / 185404 WormBaseID:WBGene00018135 Length:319 Species:Caenorhabditis elegans


Alignment Length:158 Identity:38/158 - (24%)
Similarity:76/158 - (48%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 SKPSFDRNQKPSYNRTDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAG-HLSQNQL 287
            :|.:.|:...|..:.|.::  .||.|:.:          |..|.:...:|..|::.| .:....:
 Worm    13 NKQATDKLDHPDTSETVNI--SSLALLKM----------LRHARSGIPLEVMGLMLGDFVDDYTI 65

  Fly   288 YITHIITPQQQGTP---DSCNTMHEEQIFDVQDQMQLI-----TLGWIHTHPTQTAFLSSVDLHT 344
            .:|.:....|.||.   :|.:.:::.:..|:   ::|:     .:||.|:||....:|||||::|
 Worm    66 NVTDVFAMPQSGTSVTVESVDPVYQTKHMDL---LKLVGRTENVVGWYHSHPGFGCWLSSVDVNT 127

  Fly   345 HCSYQIMMPEALAIVCAPKYNTTGFFIL 372
            ..|::.:.|.|:|:|..|..:..|..:|
 Worm   128 QQSFEALHPRAVAVVVDPIQSVKGKVML 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 33/135 (24%)
F37A4.5NP_498470.1 MPN_RPN11_CSN5 22..296 CDD:163700 36/149 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.