DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and eif-3.F

DIOPT Version :10

Sequence 1:NP_651796.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_495988.1 Gene:eif-3.F / 174478 WormBaseID:WBGene00001229 Length:294 Species:Caenorhabditis elegans


Alignment Length:136 Identity:32/136 - (23%)
Similarity:53/136 - (38%) Gaps:37/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LAGSLRLVYVPGDTMEVF------LKLALANTSKNIETC-GVLAGHLSQNQLYITHIIT-PQQQG 299
            :|.:|.:...||..|.|.      .|.:..||.:  |.| |.|.|:..:..:.:|:... |..:.
 Worm     1 MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQ--EKCMGTLMGYYEKGSIQVTNCFAIPFNES 63

  Fly   300 TPDSCNTMHEEQIFDVQDQ--MQLIT-----------LGWIHTHPTQTAFLSSVDLHTHCSYQIM 351
            ..|          .::.||  .|:|:           :||..|    |:.::|..|..|..|..:
 Worm    64 NDD----------LEIDDQFNQQMISALKKTSPNEQPVGWFLT----TSDITSSCLIYHDYYVRV 114

  Fly   352 MPEALA 357
            :.||.|
 Worm   115 ITEASA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_651796.1 USP8_dimer 11..120 CDD:462647
MPN_AMSH_like 247..419 CDD:163697 31/132 (23%)
eif-3.FNP_495988.1 MPN_eIF3f 7..291 CDD:163695 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.