DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and COPS5

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_006828.2 Gene:COPS5 / 10987 HGNCID:2240 Length:334 Species:Homo sapiens


Alignment Length:152 Identity:35/152 - (23%)
Similarity:59/152 - (38%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LKLAL-ANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTM---HEEQIFDVQDQMQL 321
            ||:.: |.:..|:|..|::.|.:....:.|........:||....|..   :|.....:::..|:
Human    63 LKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQV 127

  Fly   322 ----ITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAP-------KYNTTGFFILTPH 375
                ..:||.|:||....:||.:|:.|....|......:|:|..|       |.| .|.|...| 
Human   128 GRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVN-LGAFRTYP- 190

  Fly   376 YGLDYIAQCRQSGFHPHPNDPP 397
                       .|:.| |::.|
Human   191 -----------KGYKP-PDEGP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 35/152 (23%)
COPS5NP_006828.2 MPN_RPN11_CSN5 44..314 CDD:163700 35/152 (23%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 138..151 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.