DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2224 and STAMBP

DIOPT Version :9

Sequence 1:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001340896.1 Gene:STAMBP / 10617 HGNCID:16950 Length:424 Species:Homo sapiens


Alignment Length:439 Identity:190/439 - (43%)
Similarity:273/439 - (62%) Gaps:49/439 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDVE--PQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTL 73
            |||.  |::|::.||..|:.:||::::|..||:|||.|::|||::|..|||.|:|||||.:|:||
Human     5 GDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITL 69

  Fly    74 FIEKIRQHPDYGS-VKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQF--LASKEAERV-- 133
            ||||:.:|.||.| |..|.:|..:|:|:...|..|:|:|:||..|.:||.::  ...||||.:  
Human    70 FIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELAR 134

  Fly   134 -----KELERERERERERQRQKEREKAGSSAIPSLI------PANLHVL-----IDEG-NQPSAP 181
                 :|||:|::|..: |:|::.|:....|...:|      ...|.::     :|.| ..|..|
Human   135 NMAIQQELEKEKQRVAQ-QKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVP 198

  Fly   182 DLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPS----FDRNQKP-SYNRTDS 241
            ||......|:|.                |..:|...:|..|..:|:    .||:.|| :.:.::|
Human   199 DLEKPSLDVFPT----------------LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSES 247

  Fly   242 L-LAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCN 305
            : ....||.|.|||.....||:||.|||::.:||||:|.|.|.:|:..|||::.|:|....|.||
Human   248 IPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCN 312

  Fly   306 TMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFF 370
            |.:||::|.:|||..|||||||||||||||||||||||||||||:|:||::||||:||:..||||
Human   313 TENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFF 377

  Fly   371 ILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419
            .||.| ||:.|:.|||.|||||..|||||....|:.:.::| :.:.|||
Human   378 KLTDH-GLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRA-VTITDLR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 49/103 (48%)
MPN_AMSH_like 247..419 CDD:163697 100/171 (58%)
STAMBPNP_001340896.1 Interaction with CHMP3 1..127 55/121 (45%)
USP8_dimer 7..114 CDD:312504 50/106 (47%)
Interaction with STAM 227..231 1/3 (33%)
MPN_AMSH_like 254..424 CDD:163697 100/171 (58%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 12/12 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146886
Domainoid 1 1.000 145 1.000 Domainoid score I4585
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4719
Inparanoid 1 1.050 326 1.000 Inparanoid score I2482
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49824
OrthoDB 1 1.010 - - D411229at2759
OrthoFinder 1 1.000 - - FOG0002716
OrthoInspector 1 1.000 - - otm41439
orthoMCL 1 0.900 - - OOG6_103166
Panther 1 1.100 - - LDO PTHR12947
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1402
SonicParanoid 1 1.000 - - X1584
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.