DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and SAL1

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_014316.3 Gene:SAL1 / 855641 SGDID:S000005027 Length:494 Species:Saccharomyces cerevisiae


Alignment Length:497 Identity:91/497 - (18%)
Similarity:158/497 - (31%) Gaps:158/497 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLKRAGTEKLREVFLKYASIQK----NGEHYMTSEDFVRKFLGLFSESAF---------NDESVR 77
            |||...|:|.|::  :||.:.|    .|...:|.::.:         |||         |||:::
Yeast     2 LLKNCETDKQRDI--RYACLFKELDVKGNGQVTLDNLI---------SAFEKNDHPLKGNDEAIK 55

  Fly    78 LLANIADTSKDGLISFSEFQAFEGLLCTPDALYRTAFQLFDRKGNGTVSYADFADVVQKTELHSK 142
            :|....|.:||.::..|:|:.:..   ..::.....||..|...:|.:...:             
Yeast    56 MLFTAMDVNKDSVVDLSDFKKYAS---NAESQIWNGFQRIDLDHDGKIGINE------------- 104

  Fly   143 IPFSLDGPFIKRYFGDKKQRLINYAEFTQLLHDFHEEHAMEAFRSKDPAGTGFISPLDFQDIIVN 207
                     |.||..|                                        ||.|.|..|
Yeast   105 ---------INRYLSD----------------------------------------LDNQSICNN 120

  Fly   208 VKRHLLTPGVRDNLVSVTEGHKVSFPYFIAFTSLLNNMELIKQV-YLHATEGSRTDMITKDQILL 271
            ...|.|         |..:.:|.|..:..||.....|:.|..|. :...|:..|:...|...:.:
Yeast   121 ELNHEL---------SNEKMNKFSRFFEWAFPKRKANIALRGQASHKKNTDNDRSKKTTDSDLYV 176

  Fly   272 AAQTMSQITPLEIDILFHLAGAVHQAGWWKRRRKIPP---SSRIDYSDLSNIAPEHYTKHMTHRL 333
               |..|                     |:....:.|   .||:           |......:..
Yeast   177 ---TYDQ---------------------WRDFLLLVPRKQGSRL-----------HTAYSYFYLF 206

  Fly   334 AEIKAVESPADRSAFIQVLESSYRFTLGSFAGAVGATVVYPID------LVKTRMQNQRAGSYIG 392
            .|...:.|..|.:.....:.....|..|..:|.:..|...|.|      :.:|.:.:....|...
Yeast   207 NEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTD 271

  Fly   393 EVAYRNSWD----------CFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDK 447
            .:|...:.|          ..|.:.|..|....|.|....::.|.||.:||....::.:..:|..
Yeast   272 LLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKL 336

  Fly   448 KG-----NIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVA 484
            :|     ::..::..:|||.||.:......|::.:|.|:|.|
Yeast   337 EGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234 18/76 (24%)
EF-hand_8 51..99 CDD:290545 13/56 (23%)
EF-hand_7 81..134 CDD:290234 9/52 (17%)
EFh 84..135 CDD:298682 9/50 (18%)
EF-hand_7 111..173 CDD:290234 8/61 (13%)
Mito_carr 350..448 CDD:278578 21/113 (19%)
PTZ00169 358..631 CDD:240302 32/148 (22%)
Mito_carr 449..539 CDD:278578 11/41 (27%)
Mito_carr 544..633 CDD:278578
SAL1NP_014316.3 EF-hand_7 19..77 CDD:290234 15/66 (23%)
EFh 20..76 CDD:298682 15/64 (23%)
EF-hand_7 54..109 CDD:290234 12/79 (15%)
Dockerin_like 62..109 CDD:277547 11/71 (15%)
Mito_carr 231..335 CDD:278578 20/103 (19%)
Mito_carr 343..>402 CDD:278578 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1679
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.