DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and PEF1

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_011572.2 Gene:PEF1 / 852949 SGDID:S000003290 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:52/227 - (22%)
Similarity:88/227 - (38%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVARCQESPS-LLKRA------GTEKLREVFLK---YASIQKNGEHYMTSEDFVRKFLGLFSESA 70
            |:...|..|: |||:.      ..|.:|::.:.   :.:....|::.:|:|: ::..|.....|.
Yeast   130 PLIHNQAVPAQLLKKVAPASFDSREDVRDMQVATQLFHNHDVKGKNRLTAEE-LQNLLQNDDNSH 193

  Fly    71 FNDESVRLLANIADTSKDGLISFSEFQAFEGLLCTPDALY------RTAFQLFDRKGNGTVSYAD 129
            |...||..|.|:...|:.|.::.:||          .|||      |..:...|..|:.|:|.::
Yeast   194 FCISSVDALINLFGASRFGTVNQAEF----------IALYKRVKSWRKVYVDNDINGSLTISVSE 248

  Fly   130 FADVVQKTELHSKIPFSLD-------GPFIKRYFGDKKQRLINYAE-------FTQLLHDFHEEH 180
            |.:.:|  ||...|||.:.       ..||.|....|:.:...:.|       .|:|...|    
Yeast   249 FHNSLQ--ELGYLIPFEVSEKTFDQYAEFINRNGTGKELKFDKFVEALVWLMRLTKLFRKF---- 307

  Fly   181 AMEAFRSKDPAGTGFISPLDFQDIIVNVKRHL 212
                  ..:..|...|...||.|..:.:.|.|
Yeast   308 ------DTNQEGIATIQYKDFIDATLYLGRFL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234 15/66 (23%)
EF-hand_8 51..99 CDD:290545 13/47 (28%)
EF-hand_7 81..134 CDD:290234 14/58 (24%)
EFh 84..135 CDD:298682 13/56 (23%)
EF-hand_7 111..173 CDD:290234 18/75 (24%)
Mito_carr 350..448 CDD:278578
PTZ00169 358..631 CDD:240302
Mito_carr 449..539 CDD:278578
Mito_carr 544..633 CDD:278578
PEF1NP_011572.2 EFh_PEF_Group_I 161..329 CDD:320055 42/190 (22%)
EF-hand motif 161..190 CDD:320055 4/29 (14%)
EF-hand motif 198..227 CDD:320055 11/38 (29%)
EF-hand motif 228..257 CDD:320055 8/30 (27%)
EF-hand motif 264..298 CDD:320055 5/33 (15%)
EF-hand motif 300..328 CDD:320055 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.