DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and Slc25a22

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001171047.1 Gene:Slc25a22 / 68267 MGIID:1915517 Length:323 Species:Mus musculus


Alignment Length:298 Identity:121/298 - (40%)
Similarity:156/298 - (52%) Gaps:35/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMG 425
            |..||.:|.|.|:||||.|||:|||:.|..:    |.:..||..|.:|.||:.|:|||....|..
Mouse    15 GGIAGLIGVTCVFPIDLAKTRLQNQQNGQRM----YASMSDCLIKTIRSEGYFGMYRGAAVNLTL 75

  Fly   426 VAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASG 490
            |.|||||||..||..|.:|:.....:....|:|||..||..||:.|.|:|::||:||.||.||:.
Mouse    76 VTPEKAIKLAANDFFRHQLSKDGQKLTLPKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQ 140

  Fly   491 SKI-------------------------RAWSVVREL----GLFGLYKGARACLLRDVPFSAIYF 526
            .||                         .|..:.|:|    |:.|||||..|.||||||||.:||
Mouse   141 RKILAAQAQLSAQGGAQPSVEAPAPPRPTATQLTRDLLRNHGIAGLYKGLGATLLRDVPFSIVYF 205

  Fly   527 PTYAHTKAMMADKDGYNHPLTL-LAAGAIAGVPAASLVTPADVIKTRLQVVARS-GQTTYTGVWD 589
            |.:|:...:.........|..: ..||.:||..||..|.|.||:|||||.:.|. .:.||:|..|
Mouse   206 PLFANLNQLGRPSSEEKSPFYVSFLAGCVAGSAAAVAVNPCDVVKTRLQSLERGVNEDTYSGFLD 270

  Fly   590 ATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYEL 627
            ..:||...|||.||.||...|....:|.||:..|.|.|
Mouse   271 CARKIWRHEGPSAFLKGAYCRALVIAPLFGIAQVVYFL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 41/86 (48%)
PTZ00169 358..631 CDD:240302 121/298 (41%)
Mito_carr 449..539 CDD:278578 43/118 (36%)
Mito_carr 544..633 CDD:278578 37/86 (43%)
Slc25a22NP_001171047.1 PTZ00169 3..289 CDD:240302 114/277 (41%)
Mito_carr 6..96 CDD:365909 41/84 (49%)
Solcar 1 6..93 40/81 (49%)
Solcar 2 101..214 43/112 (38%)
Solcar 3 223..312 37/86 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.