DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and GC2

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:282 Identity:114/282 - (40%)
Similarity:157/282 - (55%) Gaps:19/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMG 425
            |..||.:|...|||:|:||||:|||..|.. ||..|.:..|||:|.:..||:.|:|||....::.
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPN-GERMYTSIADCFRKTIASEGYFGMYRGSAVNIVL 90

  Fly   426 VAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASG 490
            :.||||||||.||..|..|....|.||.....||||.||..|:|.|.|:|::||::|.||.:|:.
  Fly    91 ITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAA 155

  Fly   491 SKIRAWSV------------VRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADK-DGY 542
            .:.....|            :||.|:||||||..|..:||:.||.:|||..|........| ||.
  Fly   156 DRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKSDGS 220

  Fly   543 NHPLTL--LAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWK 605
            ...:..  |.||.::|:.:|.:|||.||:|||||.   .|:..:.|:.|...:.:.|||..||:|
  Fly   221 GEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQA---DGEKKFKGIMDCVNRTLKEEGISAFFK 282

  Fly   606 GTAARVFRSSPQFGVTLVTYEL 627
            |...|:...:|.||:..:.|.|
  Fly   283 GGLCRIMVLAPLFGIAQMFYFL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 41/86 (48%)
PTZ00169 358..631 CDD:240302 114/282 (40%)
Mito_carr 449..539 CDD:278578 39/101 (39%)
Mito_carr 544..633 CDD:278578 31/86 (36%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 109/265 (41%)
Mito_carr 16..106 CDD:278578 39/79 (49%)
Mito_carr 123..203 CDD:278578 32/79 (41%)
Mito_carr 228..302 CDD:278578 29/76 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442001
Domainoid 1 1.000 71 1.000 Domainoid score I3356
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102943at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.