DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aralar1 and GC1

DIOPT Version :9

Sequence 1:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:283 Identity:118/283 - (41%)
Similarity:169/283 - (59%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMG 425
            |..||.:|.|.|:|:||||||:|||:.|.. ||..|.:.:|||:|..:.||:.|:|||....::.
  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPN-GERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILL 91

  Fly   426 VAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASG 490
            :.||||||||.||..|.|||.|.|.:|..::::|||.|||.|::.|.|:|::||::|.||.:|:.
  Fly    92 ITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAA 156

  Fly   491 SKIR------------AWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADK-DGY 542
            :|:.            |..::::.|:||||||..|..||||.||.||||.:|....:...: ||.
  Fly   157 AKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGS 221

  Fly   543 NHPL--TLLAAGAIAGVPAASLVTPADVIKTRLQVVARS-GQTTYTGVWDATKKIMAEEGPRAFW 604
            ...:  ....||..||..||..|.|.||:|||||.:.:: |:..:.|:.|...|.:..|||.||:
  Fly   222 GEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCITKTLKHEGPTAFF 286

  Fly   605 KGTAARVFRSSPQFGVTLVTYEL 627
            ||...|:...:|.||:....|.|
  Fly   287 KGGLCRMIVIAPLFGIAQTVYYL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 44/86 (51%)
PTZ00169 358..631 CDD:240302 118/283 (42%)
Mito_carr 449..539 CDD:278578 39/101 (39%)
Mito_carr 544..633 CDD:278578 32/87 (37%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 40/77 (52%)
Mito_carr 115..213 CDD:278578 39/97 (40%)
Mito_carr 226..307 CDD:278578 30/80 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442000
Domainoid 1 1.000 71 1.000 Domainoid score I3356
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102943at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45678
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4126
SonicParanoid 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.